Sub Categories

Search

Newsletter

MIG Human (CXCL9) Maximize

MIG Human (CXCL9)

MIG (CXCL9) Human (Cat. No.# CHM-333) is a non-glycosylated 103 amino acids single polypeptide sequence that has a total  molecular weight of 11700 daltons.

More details

  • Source : Escherichia Coli.
  • Purity : Greater than 97.0%.

CHM-333

20ug

£ 160.00

CXCL9 Human (MIG)

Source:  Escherichia Coli.

Physical Appearance: Sterile filtered white lyophilized (freeze-dried) powder.

Formulation:  Lyophilized from filtered 1.0mg/ml solution containing 20mM PB at pH 7.4 and 50mM NaCl.

Solubility:  Reconstitute lyophilized in sterile water (18MΩ-cm) higher than 100 µg/ml.

Stability: Should store desiccated less than -18°C for long term storage (carrier protein required also). Once reconstituted it should be stored at 4°C and used within 2-7 days. Avoid repeated freeze-thaw cycles.

Purity:  More than 97% as observed by RP-HPLC and SDS-PAGE.

Biological Activity:  10,000-100,000IU/mg.

Amino Acid Sequence:
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT.

Synonyms: , monokine induced by gamma-interferon, CXCL9, Humig, chemokine (C-X-C motif) ligand 9, MIG, Small inducible cytokine B9, SCYB9, CMK, crg-10.

Please contact us if you require any further information

  • Source : Escherichia Coli.
  • Purity : Greater than 97.0%.
Special Offers