Sub Categories

Search

Newsletter

Adiponectin Human Maximize

Adiponectin Human

Human Adiponectin (Cat. No.# CYT-280) consists of 231 amino acids (15-244) and has a total molecular mass of 25.1 kDa.

More details

  • Source : Escherichia Coli.
  • Purity : Above 90%

CYT-280

25ug

£ 160.00

Adiponectin Human

Synonyms
AdipoQ, APM-1, Acrp30, ACDC, GBP-28, Adiponectin.

Background  

  • Is found to be secreted and expressed primarily through the adipose tissue. It has many functions which include; fatty acid metabolism, regulation of hormonal processes, energy homeostasis and the control of obesity.
  • Plays a vital role in the negative regulation of the immune systems and hematopoiesis; which involves in many cases the finishing of the inflammatory response.
  • Structure is composed of an N-terminal domain collagenous which is the proceeded by a globular C-terminal domain.


Amino Acid Sequence:
MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGI
QGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAM
LFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.

Source: Escherichia Coli.

Formulation: Liquid 1mg/ml in PBS, pH 7.4 containing 1 mM DTT.

Storage: -20°C for long term storage or 4°C for short term (7 days).

Purity:  More than 90% as determined by SDS-PAGE.

Please contact us if you require any further information.


  • Source : Escherichia Coli.
  • Purity : Above 90%
Special Offers