Sub Categories

Search

Newsletter

BAFF-R Human Maximize

BAFF-R Human

B cell activating factor receptor (BAFF-R) Human (Cat. No.# CYT-429) has a total molecular weight of 7.7 kDa and is consists of a 76 a.a. single polypeptide sequence.

More details

  • Source : Escherichia Coli.
  • Purity : Greater than 95.0%.

CYT-429

20ug

£ 160.00

Human BAFF-R (B cell Activating Factor Receptor)

Synonyms:  TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.

Background:  

  • Protein is found to be encoded by the gene TNFRSF13C. It is well to be classified as a TNF cytokines ligand family member.
  • Is a glycoprotein which is 285 amino acids in length and is known to be glycoslated on 124 residue.
  • Is a vital component in normal level immunity maintance since it is an immuno-stimulant.
  • Is a transmembrane type II protein that has been found to have expression in a large number of cells such as; stromal cells, monocytes and dendritic cells.


Source:  E.Coli

Physical Appearance:  Lypohilized white sterile filtered White powder.

Formulation: Lyophilized from filtered 1.0mg/ml solution in 500mM NaCl and 20mM PBS, pH 8.0.

Solubility: Let the lyophilized pellet dissolve completely not below 100mg/ml in sterile 18MΩ-cm H2O.

Purity:  More than 95.0% as determined by SDS-PAGE and RP-HPLC.

Amino Acid Sequence:
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.

Please contact us if you require any further information

  • Source : Escherichia Coli.
  • Purity : Greater than 95.0%.
Special Offers