Sub Categories

Search

Newsletter

BNP Human Maximize

BNP Human

B type Natriuretic Peptide Human (BNP) (Cat. No.# CYT-327) is a 32 a.a. single polypeptide sequence with a molecular weight of 3464 daltons.

More details

  • Source : Escherichia Coli.
  • Purity : Greater than 95.0%.

CYT-327

10ug

£ 160.00

Human BNP (B type Natriuretic Peptide)

Source:  E.Coli.

Physical Appearance:  Lyophilized sterile filtered white powder.

Formulation:  Lyophilized from 0.4ml PBS buffer in 0.6mM sodium chloride and 20mM phosphate buffer.

Solubility:  Reconstitute lyophilized in sterile 18MΩ-cm water more than 100µg/ml.

Stability:  Store -20°C for long term (carrier protein required).  Store 4°C once reconstituted. Avoid repeated  freeze-thaw cycles.

Purity:  More than 95.0% as determined by SDS-PAGE and RP-HPLC.

Amino Acid Sequence:
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Synonyms:  Natriuretic Peptide Precursor B, B-type Natriuretic Peptide, NPPB, BNP.

Please contact us if you require any further information

  • Source : Escherichia Coli.
  • Purity : Greater than 95.0%.
Special Offers