Sub Categories

Search

Newsletter

EBI3 Human Maximize

EBI3 Human

Epstein Barr virus induced 3 Human (EBI3)(Cat. No.# CYT-367) is a single 209 amino acid (21-229) sequence with a total molecular weight of 23.3kDa.

More details

  • Source : Escherichia Coli.
  • Purity : Greater than 90%.

CYT-367

10ug

£ 160.00

EBI3 Human (Epstein Barr virus induced 3)

Source:  Escherichia Coli.

Physical Appearance:  Lyophilized sterile filtered white powder.

Formulation:  Lyophilized from solution consisting 0.5% Mannitol and 10mM Acetic Acid.

Solubility:  Reconstitute lyophilized in sterile 10mM Acetic acid more than 100µg/ml.

Stability:  Store -20°C for long term.  Store 4°C once reconstituted. Avoid repeated  freeze-thaw cycles.

Purity:  More than 90.0% as determined by SDS-PAGE.

Amino Acid Sequence:
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTIT
DVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLK
YWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK.

Synonyms:  IL-27B, EBV-induced gene 3 protein, Epstein-Barr virus-induced gene 3 protein, EBI3, IL-27 subunit beta.

Please contact us if you require any further information

  • Source : Escherichia Coli.
  • Purity : Greater than 90%.
Special Offers