Sub Categories

Search

Newsletter

Endoglin Human, Sf9 (CD105) Maximize

Endoglin Human, Sf9 (CD105)

Human Endoglin (CD105) Sf9 (Cat. No.# CYT-389) is a 586 amino acid polypeptide with a total molecular weight of 61kDa. It also has a 6x His tag which is linked to the C-terminal.

More details

  • Source : Sf9 Cells.
  • Purity : Greater than 95.0%.

CYT-389

10ug

£ 160.00

Human CD105, Sf9 (Endoglin)

Source:  Sf9 Insect Cells.

Physical Appearance:  Lyophilized sterile filtered white powder.

Formulation:  Lyophilized from 1mg/ml sterile solution consisting 1xPBS.

Stability:  Reconstitute lyophilized in sterile PBS more than 100µg/ml

Purity:  More than 95.0% as determined by SDS-PAGE and RP-HPLC.

Amino Acid Sequence:
MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWP
REVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEA
SQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEY
SFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVL
KKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQAS
NTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPK
TGS.

Synonyms: FLJ41744, HHT1, CD105, Endoglin, ORW, ENG, CD105.

Please contact us if you require any further information

  • Source : Sf9 Cells.
  • Purity : Greater than 95.0%.
Special Offers