Sub Categories

Search

Newsletter

Endoglin Mouse (CD105) Maximize

Endoglin Mouse (CD105)

Mouse Endoglin (CD105) (Cat. No.# CYT-424) is a 581 amino acid polypeptide with a total molecular weight of 61kDa. However, due to glycosylation is 75-85 kDa when ran on SDS-PAGE.

More details

  • Source : Insect Cells.
  • Purity : Greater than 95.0%.

CYT-424

10ug

£ 160.00

Mouse Endoglin (CD105)

Source:  Insect Cells.

Physical Appearance:  Lyophilized sterile filtered white powder.

Formulation:  Lyophilized from 1mg/ml sterile solution consisting of no additives.

Solubility:  Reconstitute lyophilized in sterile PBS more than 100 µg/ml.

Stability:  Store -20°C for long term (carrier protein required).  Store 4°C once reconstituted. Avoid repeated  freeze-thaw cycles.

Purity:  More than 95.0% as determined by SDS-PAGE and RP-HPLC.

Amino Acid Sequence:
MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGT
ETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLP
EAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSFIDINHSMQILTTGEYSVK
IFPGSKVKGVELPDTPQGLIAEARKNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNK
KHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNT
IELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTL
SQEVYKTVSMRLNIVSPDLS.

Synonyms: FLJ41744, HHT1, CD105, Endoglin, ORW, ENG.

Please contact us if you require any further information.

  • Source : Insect Cells.
  • Purity : Greater than 95.0%.
Special Offers