Sub Categories

Search

Newsletter

gAcrp30 Mouse (Adiponectin) Maximize

gAcrp30 Mouse (Adiponectin)

Mouse Adiponectin (gAcrp30)(Cat. No.# CYT-432) is a 138 amino acid (111-247) polypeptide sequence with a total molecular weight of 16kDa.

More details

  • Source : Escherichia Coli.
  • Purity : Greater than 95.0% .

CYT-432

50ug

£ 160.00

Mouse gAcrp30 (Adiponectin)

Source: Escherichia Coli.

Formulation: 1mg/ml solution consisiting of 10% Glycerol, 5mM DTT, 50mM NaCl and  Tris-HCl 20mM at pH7.5.

Stability:  Store -20°C for long term (carrier protein required).  Store 4°C once reconstituted. Avoid repeated  freeze-thaw cycles.

Purity:  More than 95.0% as determined by SDS-PAGE.

Amino Acid Sequence:
MAYMYRSAFS VGLETRVTVP NVPIRFTKIF YNQQNHYDGS TGKFYCNIPG LYYFSYHITVYMKDVKVSLF KKDKAVLFTY DQYQEKNVDQ ASGSVLLHLE VGDQVWLQVYGDGDHNGLYADNVNDSTFTG FLLYHDTN.

Synonyms: APM-1, AdipoQ, Acrp30, GBP-28, Adiponectin, ACDC.

Please contact us if you require any further information

  • Source : Escherichia Coli.
  • Purity : Greater than 95.0% .
Special Offers