Sub Categories

Search

Newsletter

LIF Mouse Maximize

LIF Mouse

Mouse Leukemia Inhibitory Factor (LIF)(Cat. No.# CYT-645) is a 181 amino acid single polypeptide fragment and its total molecular mass is 20kDa.

More details

  • Source : Escherichia Coli.
  • Purity : Greater than 95.0%.

CYT-645

10ug

£ 160.00

Mouse LIF

Source:  Escherichia Coli.

Physical Appearance:  Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation:  solution of 1mg/ml sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.

Stability:  Store -20°C for long term (carrier protein required and desiccated). Store 4°C once reconstituted. Avoid repeated freeze-thaw cycles.

Solubility:  Reconstitute lyophilized in sterile water more  than 100µg/ml.

Purity:  More than 95% as observed by SDS-PAGE and RP-HPLC

Biological Activity:   100MIU/mg.

Amino Acid Sequence:
MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITR
DQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF.

Synonyms:  Differentiation- stimulating factor, Leukemia inhibitory factor, DIA, MLPLI, HILDA, CDF, LIF.

Please contact us if you require any further information

  • Source : Escherichia Coli.
  • Purity : Greater than 95.0%.
Special Offers